Friday, December 23, 2011

EMPTY. 
ZERO.
NOTHING.
ME.
YOU.
THEM.
US.
THEY.
WE.
HER.
HIS.
LOVE.
PEACE.
BEAUTY.
RICH.
ATTITUDE.
FEEL.
ALONE.

its all has it's own connection. you don't believe it ? look at yrself, then you know it. because you had trough it.

I had a great time with you. I mean my family, not you. hehe. 








What can I say ? budok nih memang cute and she's totally gedik 100%. no doubt.

 but still, I love her.

Sunday, December 18, 2011


I had been in that situation. The moment where you can't depends on someone else. The moment where you just making a fake smile on your face all the time. The moment where You just wanna tell them the truth. 
But You just can't. 



But now, I am not that girl. I am a happy girl. I am a girl who just live her life. I am a girl who just spending a lot of time with her loves one wisely. I am girl who don't believe the words 'BESTFRIEND'. I am girl who believe there's nothing last forever. I am girl who just depends on my family for my happiness. I am girl who everyone loves or hate. I am girl who just independent on her own. I am girl who just starting a new life. 
I am a girl. I am a friend. I am lover. I am a daughter. 
I am a human being.


 I am me.
I MISS YOU.
I MISS MY BOOKS.
I MISS MY SCHOOL BAG.
I MISS MY UNIFORM.
I MISS MY PENCIL'S BOX.
I MISS MY CLASSMATES
I MISS MY TEACHERS.
I MISS MY SCHOOL.
I MISS MY CLASS.
I MISS MY FRIENDS.
I MISS MY FAMILY.
I MISS MAISARAH & BELLA.
I MISS MY MEMORIES.
I MISS EATING 'KEREPEK' WITH MY CLASSMATES.
I MISS THEM.
I MISS ALL OF THEM.



period.

mama, please don't let me crying over this.

mama, please don't let me crying because I miss all of those things. 

mama, please don't let my tears streaming down my cheeks.




Monday, December 12, 2011

VINTAGE




Ilovethisshirt.Cantiksangatkan? Kurusss,tolongbelikansayabajumacamnih,bolehtak? Sayajanjikalauawakbeli,sayaakansayangawaksangatsangat. Biarsayadahsayangawakpun,tapikalauawakbeli,
lagiperasaansayangsayakatawakmenebalnebalgituuuuu. 

takpahamkah? takpa, sayapahamsorangsudohlaaa.

*no motif at all kan ? biar laaaa, blog cheq kan ? bukan blok hapaq hehe xD



P/S:Maria Elena dah tunang dah, congrats to her, hope you'll be happy with him through thin and thick yaaa!


Sunday, December 11, 2011

THINGS


yeaa, I need new one, desperately, anyone ? help me pleaseee ? *puss in boots cute face xD


bags ?

OR MAYBE

blackberry bold 4 ?

OR MAYBE

rolling stone's shirt ?

OR MAYBE

an IPHONE ?

OR MAYBE

BRITISH's shirt ?

OR MAYBE MAYBE

VAIO's lappy ?


heheheheheheheheh, dadddyyyyyyy :) *wink
COUPLE


Girl: ... B, nnti b naik melaka jgk laa op ?
Boy: tak kot, why ? nak ikut ? :p
Girl: haha mcm laa blh ikut, sbb bby salah satu family ibu kan kat melaka tu haha :p
Boy: haha ikut je :p
Girl: then kalu org tnye bby ni sape, nk jwb ape ? haha :p mnantu sulung ibu ke ? :p
Boy: ho jwab je gitu :p
Girl: haha maknenye betul kaa kan ? eh jap, kire kalu gitu, bby bini b ah ? :D
Boy: bini pertama :p
Girl: oh okayyy :p bini kedue ? ketiga ? keempat ? dieorg mane ? kan nnti tk psl psl srang bby kat melaka sbb jealous :p
Boy: tkpe, b buat keje kemaas, tkkan kantoi nye :p
Girl: ye laa, nnti fmly b ambk gmbr dgn bby, then post kat FB, then bini bini b tgk, mapuss b, nnti cerai berai kan ? haha :p
Boy: ho laa :p
Girl: then b nak laa cerai berai dgn dieorg ? dgn bby taknk cerai berai ke ? :p
Boy: dgn bby taknak :P




Its just another story of one girl and one boy. the end :)
OMBAK RINDU


tak payah laa aku nk explain cerite ni kan, sbb almost every blog yang aku visit, mesti ade story psal cerite nih, so kalu korang belum tengok, nk tengok, pergi ah, okayy je laa, tapi kalu tk pergi pun, takpe jugakk, sbb biase ah, ending cerite orang melayu, tak pernah nk ending mcm betul betul ending. kalu korang tak paham mksud ending aku, tkpe, it's sokayy. but conclusion aku untuk cerite nih, it's fun laa boleh laaa hehe :) lagu die pun best, tapi seriously every-time part Adira nyanyi, mmg naik bulu roma aku, tapi sekejap je laa, and the best part aku tak nngis pun, mmg sedeh tapi tak laa sedeh sapa nk meleleh air mate hehe. okay, maybe aku tgh happy so tkde prasaan nk nngis lebeh lebeh. *cheers :)


tapi kan ape perasaan korang kalu korang tgh tngk wayang, then tibe tibe orang blkg korang CAKAP TAK BERHENTI since start the movie sapa laa the end ? macam bangang je kan, pissed off  gile dengan orang belakang aku kat cinema tadi, aku tahu laa korang nk share pendapat korang psal movie, tapi cakap laa lepas hbs movie, ni dh laa tak hormat orang lain langsung, nk buat lawak pulak, ketawa tak sedar diri and pndai pulak gatal gatal dengan each other. mcm laa korang je couple yang ade kat cinema tu nak buat gatal gatal mcm Hariz dengan Izzah ? haishh, even kakak aku dgn byfriend die pun pndai nk diam, tak pulak gedik terlebih mcm kau, haishh, sabar je laa dengan manusia yang tidak pandai hormat orang lain ! *cool, fake smile. -____-




but that's not my point writing this post, It's about the main cast, Maya Karin. ohmaiii, mcm tak percaya je rezeki aku hari ni sbb dapat jumpe face to face dgn die, she's cool. she's funny. she's beautiful laa. walawehh :) time habis je cerita tu, pintu sign 'KELUAR' tak buke buke, pelek gileee. then out of sudden, ade sorang perempuan ni sruh tunggu dulu and tanye whether this story best ke tak, then die panggil Maya Karin. blurrr sebentar aku bile tibe tibe orang jerit, rupenye die datang kat cinema nih sbb nak main game, kire sape best, dapat hadiah dari Ombak Rindu.


part game nih, seriously mmg fun habisss ah. sorang sorang mmg gile ahh, first person nk menang kene tahu colour kasut Aaron Aziz, alahh, sape tak tahu, semue berebut nk jawab, las las pak cik nih yang dapat, kecoh diee ! haishh haha :D suke laa tu pak cik sbb dapat jumpe orang lawa kan ? ;) then yang secong part, kene nyanyi lagu Ombak Rindu, haha, alahhh, mamat ni punye laa semangat nk nyanyi, bile pergi depan, salah nyanyi, ape laaaaa ? tapi aku paham, sape tak blurr or lupe kan kalu dapat pergi depan, and cakap dgn Maya Karin and she's laughing smiling like all the time right into our face aite ? dah laa mamat tu salah lirik, org lain yang nyanyi pun salah jugok, sbb excited jumpe Maya. tapi nasib baik die dapat jugak hadiah tu, lucky you mamat !


part ketiga pula, die tnye sape yang blakon jadi Pak Dollah, time nih, ade sorang perempuan nih terus angkat tangan and jawab, mmg cnfrm ah die menang, sbb question ni mmg killer question laa, sbb semue diam, tapi buat buat tahuu haha. then part four, die tnye sape pngarah cerite nih, sorang mamat ni dapat jawab and die dapat novel Ombak Rindu. aku punye laa blurr, sapa tak tahu nk buat ape, nk tgkap gmbar die pun tak ingt sbb ye laa, dh laa cinema tu sejuk, aku pulak tgh tahan kencing plus excited jumpe die. *aku excited mcm orang darat pun aku tak kisah sbb die mmg lawa in real life, her smile mmg nmpak gile ikhlas :)


ni yang last part punye, yang ni mmg fun ah, sbb dieorg kene blakon scene dengan Maya, and script kene same mcm dlm Ombak Rindu haha. masing masing nk blakon tapi bile blakon, salah sricpt, mmg lawak ah, dh laa ade yang buat script sendiri, in fact mak cik ni dah laa salah script, salah watak pulakk. sepatutnya mak cik ni jadi Hariz, Maya jadi Mila, tapi mak cik nih buat script untuk Mila pulakk, haha :D adoiii, pening Maya time tu haha. part acting nih, mmg kecoh ah satu cinema dengan gelak ketawa sbb tak tahan dgn acting sorang sorang. Maya pulak nampak lebih gedik dari Lisa bile die blakon jadi Mila, nmpk real sampai die tolak tolak mamat nih, *suke laa mamat tu, haha :D tapi bagos laa mamat nih sbb nmpk sngt die suke cerite nih even die buat sript sendiri. dah laa bile die sebut perkataan 'accept' mcm lain je, and die speaking gune ayat sendiri, mmg lawak ah, even Maya sendiri pun terkejut haha :D and orang orang yang blakon dengan Maya dapat hadiah. 


Seriously jumpe Maya Karin is like one of my dreams come true. walaweh, die mmg lawa, PERIOD ! 












nice meeting you Maya Karin :)

P/S: Yeaaa, pelik kenape bnyak gmbr org lain dgn Maya ? oh well, manusia kan ? pantang nampak artis, mule laa berebut nk tgkap gmbr, aku sempat tgkp gmbr die dgn org lain yang aku sendiri pun tak tahu name ape, sedangkan aku yang nk ambik gmbr die personal pun tak boleh sbb manusia manusia yang besar terlalu obsessed sampai sanggup hepet aku mcm aku ni semut, so aku pun give up je laa, tapi gmbr ni bukan FAKE oky ? that's for sure, thanks :)

Friday, December 9, 2011

EYES



The beauty of a woman must be seen from in her eyes, because that is the doorway to her heart, the place where love resides.

- Audrey Hepburn


Thursday, December 8, 2011

FACEBOOK




- I want have a lot of quality time with you. In real life. Fight, crying, happy, laugh, those memories, I wish It will stay forever. Like you said, 'Pelengkap rusuk kiriku'


*Sincerely from me. ;) 


aku of course laa tak tag name kau kan, sbb kau mesti dh tahu kat sape aku nk tuju. takkan aku nk tuju kat mamat bangla pulak kan, name pun kau je boyfriend aku. then tibe tibe kau kate: pergh, kau copycat ayat kembar aku :p 
amboiii, sedak mulut kau je kan, ayat ori okayy ? haha, then one minute later, on my notification, 


'Aril Adzim tagged you in a post.
aku mcm dah agak kau mesti nak kenakan aku kan, sbb kau ni annoying tahap maximum, so mesti lahhh kau suke sakat aku kan. but I was wong, completely wrong. 

- I want have a lot of quality time with you. In real life. Fight, crying, happy, laugh, those memories, I wish It will stay forever. Like you said, 'Pelengkap rusuk kiriku'

Nur Azzanizawaty 

seriously aku mmg terkejut, eh, ntah mimpi ape, tak pernah pun die mcm nih, tibe tibe buat mcm tu, dh laaa copy and paste ayat aku haha. aku rase tak pernah pun rase sebahagia mcm nih. aku tk maksud yang aku tk bahagia dengan kau okayy ? aku bahagia, tp kali nih aku lagi bahagia, kau layan aku mcm aku permaisuri. kalah layanan kau yang sebelum nih. 

actually aku takot sebenarnya post bnyk bnyk bende psal kite lately, nmpk mcm aku tgh angau dengan kau, tp nak buat mcm mne, nme pun happy kan. aku just hrap kite kekal, insya'allah moga moga Allah panjangkan jodoh kita. sbb actually kau mmg bnyak tolong aku, sbb kau, aku dah tak malu pakai tudung. eh jap ? aku malu dulu ? yeaaa, aku admit dulu aku malu pkai tudung, sbb aku rase kalu aku pkai tudung, mmg confirm tudung aku senget, aku mmg tak pandai pkai tudung lawa lawa. tapi sebab kau kate aku nmpk okeyy je, makin lame aku makin selesa. and kau pun tolong jage pakaian aku, kau tolong aku untuk hormat diri sendiri. thank you. I really appreciate that. 

and aku wish kau janganlah bace blog aku, sbb kalau kau bace blog aku, aku tahu sangat kau mesti berubah, lagi annoying, and paling penting kau mesti tak mcm ni lagi lepas nih. haha. sbb kau ni pantang dipuji, kalu puji siket, mule laaa back to old Ariel. haishhh, geram aku. so better I keep this as my secret. puji kau kat belakang, so I can enjoy this feeling. feeling yang buat aku rase bahagia, you know ? feeling yang buat kau senyum jee bile kau nmpk orang yang kau sayang. haaaa ! like that laaaa. so that's my post. our story.



Iloveyoualot, MOHD SHAHRIL SHUBADI :)


P/S: re-reading this post while listening to 'Need You Now' makes me feel sad, thinking about how bad we are before. one year ago is our tough year. we fight really bad. we cried so bad. but now, we're happy. we're laugh together. we're making jokes. we're cried because we do love each other. what should I say ? Thank you, Iloveyou :) Don't break my heart like before. It hurts. It nice seeing you smile nmpak gigi when I saw you ptg smlm.

3:00 a.m. 9/12/2011.Friday.
FUN


Ya Allah, funnye aku hari nih. mcm mane laa tak fun, dpt jumpe my adorable si kurus, then mama and papa is coming over. oh my mama, lame kite tak bersua muke. frst thing yang mama buat mesti nk cari gadoh kan ? aishh, ade jee bende yang adik buat tak kene kan ? dh laa buat muke gitu sokmo, geramm jee. tp takpe, sbb lame sngt kite tk jumpe, adik mngalah dgn mama oky ? lgpun you're the best laa ma :) eh, adik puji mama tau even td mama ngajim kat adik, huishh, benci I haha.


Okay, stop laa cerite psal mama. tamat oky ? cerite psal my adorable-annoying kurus lop. oh frst time jumpe die slps berpisah di ampang petronas haha :D still remember the moment when I get so mad ? tu laa, sape suruh diam membisu padahal dah tahu sesat, dh laa tgh malam weh, ishh, saje nk sruh aku naik angin and mnangis kan ? but seriously, Imissthatmoment, your face, awww, seeking for my forgiveness, you touched my face, siap lap lagi air mate I yang jatuh, so sweet of you, *eeee, bluek ! haha. okay, admit, suke tau si kurus lap air mate, so sweet gitu hehe :D 


Okayy, enough with that moment, eh kau, thank you yee sbb blnje I satu kasut yang mmg I admire dari dulu hehe :D ohmaii, you're so sweet :) asal kau dtg KL je, kau berubah ah ? I mean you're getting more concerned about me, pndai je nk mnje mnje kan hehe. but thank you, Iloveit. seriously, kdg kdg nk nangis je bile tngok prngai kau skrg, sbb kat Trgganu tak mcm tu pulak. tp tkpe, name pun dduk jauh kan, kau Ampang, aku Genting Klang, jauh tu weh kalu nk jumpe. ishkk, emosi je lebih aku nih. at least aku puji kau kurus haha.


Thanks jugak sbb sanggup blnje aku dgn kkak mkan kat Secret Recipe, haishh, what can I do ? you're just so loving in one minute,  then annoying balik. confirm 100% kau akn annoying gile bile balik Trgganu. tkpe tkpe, I sabar oky ? sbb I sayang you laaa. *eeeeeeeee :p tapi seriously sedeh bile kite kene berpisah kat monorail tadi. kau naik ikut sini, aku naik ikut sana. watching you from the monorail is killing me. I think It's because the nightmare. I wish you know how bad is that dream even aku tahu kau mesti gelak ketawa sbb dream aku mmg tk logik. tp real bagi aku hee. tkpe, kite strong okay ? 


Beside nnti pun kite akn far away jugak sbb msg msg masuk U, eee, tue doh kite, tp muke mude lagi kan ? hehe. goshh, Imissyouoredy. how come meh ? ishkkk, haha, next time kite jumpe lagi oky ? lagipun kite kan balik same Terengganu kan ? so Im sorry kite tk blh jmpe esok, It's my family time hehe. You take care of yourself okay ? hopefull you'll be just allright. amin.





-eh, nmpk buruk je kasut ni dlm gambar, tp tkpe, aku suke kan, kau pilih kan, so mesti ah lawa aite ? 


P/S: twittering with Madie, and comment comment dengan Ibu, fun, rindu dengan Ibu, sbb lame tk jumpe Bella, Imissherbadly. and Madie ? how come we can be this good ? like you said, 'dulu kat sekolah, gitu je, skrg smngat nk jmpe' haha, well, Madie, people change aite ? gile fun twit dgn Madie pagi pagi bute mcm tu, hlang ngatok haha. till we meet yaa Madie at SS4. amin :)

Wednesday, December 7, 2011

CRAPPY 

This is my another crappy post. Tapi Its sokayy laa, name pun blog aku kan ? I had a nightmare. name pun nightmare, so of course It's bad. really bad. really bad sampai aku boleh bgn tido, then crying out of sudden. bile bangun tido, baru laa realise It's just a dream. omaiii ! Im scared, Im just praying that If It's really happen, just let me have some fun with him. just let me have a good memories with him. amin. 


before Im writing this post, bace bace laa balik post yang dulu dulu kan. suke tengok blog sendiri sbb lawa, kiut miut. mmg laa aku suke, It's my blog aite ? kalu dulu, post pasal my mom, my gemok, and my friends. so pathetic life I am ni kan ? *sigh tp nk buat mcm mne, It's life, kalu tak pathetic, kau ingt best ke hidup kau ? tak kan, mesti ade drama, emosi siket siket baru ah fun, baru nmpk siket mcm mu ni human being. haha.

TERKEJUUTTT MAK ! astghafirullahalazim *lupe psl ejaan betul ke tak please. gane aku tak terkejut, while doing this post, bunyi guruh, ya allah ! takotnyee aku, hanya tuhan je yang tahu. dh laa duduk kat tmpt tnggi kan, mesti laa takot. I wonder bile dunia ni nk kiamat, semue umat dah bertaubat ke ? I know tak baik cakap mcm nih, tp lets think about it. bakpe time kite dying, kite accident/incident baru laa kite nk sedar ? baru kite nk taubat mase tu ? tp kan, ade juga manusia yang mmg tak taubat taubat lepas accident or what-so-ever nih. *sigh manusia manusia.

tp jujur aku kate, aku pun manusia jugak, even aku pun belum tahu aku taubat ke tak, tapi Im just praying yang aku mati dalam iman kalu Allah nk ambik nyawa aku yang sememangnya hak die. sbb mmg semue dalam dunia ni semua hak milik Yang Maha Kuasa. Ya Allah, besarnye kuasa tuhan kan ? tak pernah terfikir pun dalam hati minda kita yang bijaksana nih mcm mane manusia boleh hidup dengan kulitnya yang dtg dari tanah ? Ya Allah, aku bersyukur dengan nikmat Tuhan. Aku sebagai umatnya memohon agar ibuku diberi kekuatan untuk mnghadapi penyakitnya itu, dan moga moga keluargaku dimurahkn rezeki. amin ya rabbal alamin. 

okayy, kalu korang nk kate aku nih buat alim dlm blog aku nih, Its sokayy, yeaaa, aku admit, aku mmg buat alim, tp dengan niat ikhlas aku memohon kepada-Nya agar dimakbulkan hajatku. Allah Yang Maha Besar, Maha Kuasa, Maha Mengetahui. siapa kita nk judge orang kate org tu buat alim ke tak, even orang yang suke berparti pun kdg kdg mntak hajat dengan Allah, so let them be laa kan ? hidup dieorg. kite yang hidup just ikhlas dalam setiap perkara kite buat especially sembahyang. 


azan sembahyang, doa, surah yassin & al-quran lagu paling sedap dalam universe nih.

FREEDOM


okay, yeaa, that tittle, freedom ? am I ? like seriously. oh yeaaa, It's true laa weh. walaweh, dah free dah aku. free from school. free from class. free from waking up in the early of the morning. free from getting dress up in school uniform. free from involved in school. PERIOD


so back to my story. happy ? excited ? eager ? sad ? loneliness ? semue ade time nih. sbb ? come on lahh, mule mule boleh laa nk excited or nk nangis mcm nk rak bile dah habis exam, tp lepas 1 bulan, mule laa bosan. tp aku ? tak sampai 1 bulan pun, dah rindu kat sekolah. haha. oh yeaa, BTW aku habis Sijil Pelajaran Malaysia(SPM). seriously mcm tak percaya langsung. selama 11 tahun zaman aku sekolah, tak pun rase free, boleh duduk goyang kaki kat rumah selepas bulan 12. biasenye bulan 12 tu dah kene stop stayed late at night, kene prepare for school, kene bljr supaye tk liat bgn pkul 6.15 a.m. and skrg tk pyh buat tu sumue. tibe tibe rase mcm lawak ah pulak. sbb dulu beria-ia sngt nk get away from school. tp bile dah get away, rindu smakin membuak buak dalam diri nih, rase mcm nk glepor je *bak kate org Trgganu. 


so sekarang mmg cnfrm laa budok budok lepas SPM sibuk nak ambik lesen krete kann ? sape tk sabar ? aku pun dulu glepor tangan nk sentuh stereng krete *bhgian dok sabo nk bawok krete gi jalan jalan kan. tp lps exam, tibe tibe glepor tu hilang. dok rase nok ambik lesen cepat cepat. dok tahu laa bakpe. mybe sbb org ramai ambik. or mybe rase nk duduk kat sekolah, dalam dewan, jawab exam. haha. tp seriously tak rase happy pun habis exam. reason ? sbb still fikir psal result, how careless I am during the exam. mcm mcm hal nk fikir, that's why tak happy.


'stop thinking about that. you're free now. just pray for yr succes. doa kat Allah supaye pemeriksa baik hati, tolong kite utk dpt mrkh lebih. and hopefully our efforts will give us joyness soon'- my mom. oh my, what you should I say ? she knows me better than I am. I still remember her face when I can't really answer Pendidikan Islam's questions very well. sbb sakit punye pasal time tu. her face full with sadness, prayers and rase bersalah. all I can said on that time 'dok tahu laa mama.' and then Im crying without let her know. my tears streaming down my cheeks just like that after she asks me whether I can answer It or not. 


Im just hoping that Im getting It right. and all I can say is I am not free. I am not free from school. I am just leaving It. I am just take a rest from school. Because at the end, I will come back. I will return to that school again. and when I come back, the hall, the school hall akn penuh dengan doa budak budak lepasan SPM, wishing, praying, hoping that they're will getting straight A's. so do I.


 so till we meet again, school. :)




I miss them. I miss my classmate. I miss my Sir Ibrahim.